Murine TNF alpha Protein

TNFα is acytokine that Tumor necrosis factor alpha (TNF-α), is a member of the TNF superfamily. It is a pleiotropic molecule that plays a central role in inflammation, apoptosis, and immune system development. TNF-α is produced by a wide variety of cell types. Mature extracellular domain of murineTNF-α forms a soluble trimer. TNF-α trimers bind the ubiquitous TNF RI and the hematopoietic cell-restricted TNF RII, both of which are also expressed as homotrimers. TNF-α is a key cytokine in the development of several inflammatory disorders.

Purity: > 98%, by SDS-PAGE under reducing conditions and visualized by Coomassie stain.

Protein Sequence:
LRSSSQNSSDKPVAHVVANHQVEEQLEWLSQRANALLANGMDLKDNQLVVPADGLYLVYSQVLFKGQGCPDYVLLTHTVSRFAISYQEKVNLLSAVKSPCPKDTPEGAELKPWYEPIYLGGVFQLEKGDQLSAEVNLPKYLDFAESGQVYFGVIAL

Formulation: Supplied as a 0.2 μm filtered solution in PBS at 100 μg (1mg/ml) in sterile PBS containing at least 0.1% human or bovine serum albumin.

Storage instructions: Store at -20°C (Recommended).