Human IL-1 beta

Both proteins are produced by a wide variety of cells in response to inflammatory agents, infections, or microbial endo-toxins. While IL-1 alpha and IL-1 beta are regulated independently, they bind to the same receptor and exert identical biological effects. IL-1 RI binds directly to IL-1 alpha or IL-1 beta and then associates with IL-1 R accessory protein (IL-1 R3/IL-1 R AcP) to form a high-affinity receptor complex that is competent for signal transduction. The human IL-1 beta cDNA encodes a 269 amino acid precursor. A 116 amino acid pro-peptide is cleaved intra-cellularly by the cysteine protease IL-1 beta -converting enzyme (Caspase-1/ICE) to generate the active cytokine. The 17 KDa mature human IL-1 beta shares >80 % amino acid sequence identity with mouse IL-1 beta.
Protein Sequence: APVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLFESAQFPNWYISTSQAENM PVFLGGTKGGQDITDFTMQFVSS

Purity: >98%, by SDS-PAGE under reducing conditions and visualized by Coomassie stain.
Formulation: Supplied as a 0.2 μm filtered solution in PBS at 50 μg(1mg/ml) in sterile PBS containing 50% Glycerol.

Storage buffer: Phosphate Buffer pH 7.4, containing 50% Glycerol without azide.
Storage instructions:   -20°C (Recommended).