Human IL-6 Protein

Interleukin-6 (IL-6) is a 22-28 kDa phosphorylated and variably glycosylated cytokine that plays important roles in the acute phase reaction, inflammation, hematopoiesis and bone metabolism. Mature human IL-6 is 183 amino acids (aa) in length and shares 39% amino acids sequence identity with mouse IL-6. Aberrant IL-6 activity contributes to chronic inflammation in obesity, insulin resistance, inflammatory bowel disease, arthritis, sepsis, and atherosclerosis.
Protein Sequence:

VPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM

Purity: > 98%, by SDS-PAGE under reducing conditions and visualized by Coomassie stain.
Formulation: Supplied as a 0.2 μm filtered solution in PBS with 50% Glycerol.

Storage buffer: Phosphate Buffer pH 7.4, containing 50% Glycerol without azide.
Storage instructions: -20°C (Recommended).